PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof003084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 261aa    MW: 28697.6 Da    PI: 4.1967
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17368963PU_refUnigeneView CDS
PUT-157a-Saccharum_officinarum-118143PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.2e-134889346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +WT eE +ll+++ + +Gg+ W+ Ia+++  ++t  qc +++++
        Sof003084 48 SWTDEETLLLLEGLEIFGGK-WAEIAEHVA-TKTKAQCMLHFLQ 89
                     7*******************.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF578509.42E-6225No hitNo description
PROSITE profilePS5129321.6884495IPR017884SANT domain
SMARTSM007178.5E-134593IPR001005SANT/Myb domain
SuperFamilySSF466892.84E-134599IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-94789IPR009057Homeodomain-like
PfamPF002494.3E-124890IPR001005SANT/Myb domain
CDDcd001675.25E-46690No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
RKRYHCRTQA DFDLCCDCYN EGKFDPGMAK TDFILMDSAE VSGASGTSWT DEETLLLLEG  60
LEIFGGKWAE IAEHVATKTK AQCMLHFLQM QIEDRFHDGE DINQNIPVST EQATTEKVIA  120
DTSEKMEVED KVEGRDTADE KASENTEGSC EETKTEDANV VVNKDTQNSG GTDSGASPST  180
GEPKQSSDEQ PIVKENPQIY VLLVKNINVA IDILKSAFDG AGHTPEYERS FADARNPIMA  240
LAAYLTGLVE NDNTTTSSRI H
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.103890.0crown| inflorescence| leaf| meristem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466552.11e-147hypothetical protein SORBIDRAFT_01g009800
TrEMBLC5WMX11e-147C5WMX1_SORBI; Putative uncharacterized protein Sb01g009800
STRINGSb01g009800.11e-147(Sorghum bicolor)